PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna08535.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 358aa    MW: 41253.1 Da    PI: 9.6119
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna08535.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.59.7e-16655148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                             r+rW +eEd ll  +vkq+G++ W++++++m   ++R +k+c +rw +yl
  mrna08535.1-v1.0-hybrid  6 RQRWRPEEDALLRAYVKQYGPREWNLVSQRMStpLNRDAKSCLERWKNYL 55
                             89**********************************************97 PP

2Myb_DNA-binding383.9e-1261105147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
  mrna08535.1-v1.0-hybrid  61 KGSLTEEEQRLVICLQEKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 105
                              6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.395159IPR017930Myb domain
SMARTSM007172.2E-13557IPR001005SANT/Myb domain
SuperFamilySSF466899.17E-226100IPR009057Homeodomain-like
CDDcd001671.38E-8855No hitNo description
Gene3DG3DSA:1.10.10.607.5E-21861IPR009057Homeodomain-like
PfamPF139219.7E-14970No hitNo description
PROSITE profilePS5129418.86860110IPR017930Myb domain
SMARTSM007172.5E-1060108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-1462104IPR009057Homeodomain-like
CDDcd001672.22E-765106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MEMKERQRWR PEEDALLRAY VKQYGPREWN LVSQRMSTPL NRDAKSCLER WKNYLKPGIK  60
KGSLTEEEQR LVICLQEKHG NKWKKIAAEV PGRTAKRLGK WWEVFKEKQQ REQKNNNTVV  120
QPIEEGKYDR ILETFAEKLV TECPAPYLMA TSNGAFLHNE ASPAPSMLPP WLSNSNGPSH  180
ARAPSPSITL SLSPTVAPSR TSPPIPWLQP DRGPENSFAL NNLPPHVSVP CGENYVISEL  240
VECSRELEEV HRAWAAHKKE ASWRLRRVEL QLESEKACRK REKMDEIEAK VKALREEQKA  300
ALDRIEAEYR EQIAGLRRDA EIKEQKLADQ WSAKHMRLTQ FLEQMGGRPR LAEPNAR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-15994789C-Myb DNA-Binding Domain
1mse_C2e-15994789C-Myb DNA-Binding Domain
1gv2_A2e-15994789MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004292944.10.0PREDICTED: transcription factor AS1-like
RefseqXP_011459109.10.0PREDICTED: transcription factor AS1-like
SwissprotO809311e-160AS1_ARATH; Transcription factor AS1
TrEMBLM5WNZ50.0M5WNZ5_PRUPE; Uncharacterized protein
STRINGPOPTR_0006s08610.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25973369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-153MYB family protein